/*  A Local nucleotide-amino acid Alignment Program (LAP):

    copyright (c) 1996 Xiaoqiu Huang
    E-mail: huang@cs.mtu.edu
    The source code of LAP is freely available for academic use.
    The author does not offer any warranties or representation,
    nor does the author accept any liabilities with respect to the program.
    No part of this program may be employed for commercial use
    without prior written permission of the author.
    For commercial use, contact the Intellectual Property Office of
    Michigan Technological University.


	      Xiaoqiu Huang
	      Department of Computer Science
	      Michigan Technological University
	      Houghton, MI 49931

    Proper attribution of the author as the source of the software would
    be appreciated:
       Huang, X. and Zhang, J.  (1996)
       Methods for comparing a DNA sequence with a protein sequence,
       submitted to CABIOS.

    Acknowledgments
       The author thanks Jinghui Zhang for suggestions that significantly
       improved this software.

    The LAP program computes a local alignment between a DNA sequence
    and a protein sequence.
    LAP handles frameshifts and long introns in the DNA sequence.
    It delivers the alignment in linear space, so long sequences can be aligned.
    If DOUBLE = 1, then both strands of the DNA sequence are compared
    with the protein sequence and one of the two alignments with the larger
    score is reported. If DOUBLE = 0, only the plus strand is compared
    with the protein sequence.

    The LAP program is written in C and runs under Unix systems on
    Sun workstations and under DOS systems on PCs.
    We think that the program is portable to many machines.

    Sequences to be analyzed are stored in separate files.
    An input file contains all characters of a sequence, separated by
    newline characters, in linear order. No other characters are allowed.
    Sample DNA and protein sequence files are attached below.

    To find the best alignment of a DNA sequence in file DNA and a protein
    sequence in file Protein, use a command of form

	   lap  DNA  Protein  gs  BLOSUM62  q  r > result

    where lap is the name of the object code, gs is the minimum length
    of any deletion gap in the DNA sequence receiving a constant gap penalty,
    BLOSUM62 is a specially formatted BLOSUM62 matrix, q and r are
    non-negative integers specifying gap-open and gap-extend penalties,
    respectively. The score of an i-symbol gap is -(q + r * i).
    Any deletion gap of length greater than gs is given a score of
    -(q + r * gs). The output alignment is saved in the file "result".
    A set of possible values for the parameters are: gs = 10, q = 10, r = 2.

	BLOSUM62 matrix:
ARNDCQEGHILKMFPSTWYVBZX
 4
-1  5
-2  0  6
-2 -2  1  6
 0 -3 -3 -3  9
-1  1  0  0 -3  5
-1  0  0  2 -4  2  5
 0 -2  0 -1 -3 -2 -2  6
-2  0  1 -1 -3  0  0 -2  8
-1 -3 -3 -3 -1 -3 -3 -4 -3  4
-1 -2 -3 -4 -1 -2 -3 -4 -3  2  4
-1  2  0 -1 -3  1  1 -2 -1 -3 -2  5
-1 -1 -2 -3 -1  0 -2 -3 -2  1  2 -1  5
-2 -3 -3 -3 -2 -3 -3 -3 -1  0  0 -3  0  6
-1 -2 -2 -1 -3 -1 -1 -2 -2 -3 -3 -1 -2 -4  7
 1 -1  1  0 -1  0  0  0 -1 -2 -2  0 -1 -2 -1  4
 0 -1  0 -1 -1 -1 -1 -2 -2 -1 -1 -1 -1 -2 -1  1  5
-3 -3 -4 -4 -2 -2 -3 -2 -2 -3 -2 -3 -1  1 -4 -3 -2 11
-2 -2 -2 -3 -2 -1 -2 -3  2 -1 -1 -2 -1  3 -3 -2 -2  2  7
 0 -3 -3 -3 -1 -2 -2 -3 -3  3  1 -2  1 -1 -2 -2  0 -3 -1  4
-2 -1  3  4 -3  0  1 -1  0 -3 -4  0 -3 -3 -2  0 -1 -4 -3 -3  4
-1  0  0  1 -3  3  4 -2  0 -3 -3  1 -1 -3 -1  0 -1 -3 -2 -2  1  4
 0 -1 -1 -1 -2 -1 -1 -1 -1 -1 -1 -1 -1 -1 -2  0  0 -2 -1 -1 -1 -1 -1
    A sample DNA file:
GCCAGTGCCAGAAGAGCCAAGGACAGGTACGGCTGTCATCACTTAGACCT
CACCCTGTGGAGCCACACCCTAGGGTTGGCCAATCTACTCCCAGGAGCAG
GGAGGGCAGGAGCCAGGGCTGGGCATAAAAGTCAGGGCAGAGCCATCTAT
TGCTTACATTTGCTTCTGACACAACTGTGTTCACTAGCAACCTCAAACAG
ACACCATGGTGCACCTGATCTGAGGAGAAGTCTGCCGTTACTGCCCTG
TGGGGCAAGGTGATACGTGGATGAAGTTGGTGGTGATATGGCCCTGGGCAGGTT
GGTATCAAGGTTACAAGACAGGTTTAAGGAGACCAATAGAAACTGGGCAT
GTGGAGACAGAGAAGACTCTTGGGTTTCTGATAGGCACTGACTCTCTCTG
CCTATTGGTCTATTTTCCCACCCTTAGGCTGCTGGTGGTCTACCCTTGGA
CCCAGAGGTTCTTTGAGTCCTTTGGGGATCTGTCCACTCCTGATGCTGTT
ATGGGCAACCCTAAGGTGAAGGCTCATGGCAAGAAAGTGCTCGGTGCCTT
TAGTGATGGCCTGGCTCACCTGGACAACCTCAAGGGCACCTTTGCCACAC
TGAGTGAGCTGCACTGTGACAAGCTGCACGTGGATCCTGAGAACTTCAGG
GTGAGTCTATGGGACCCTTGATGTTTTCTTTCCCCTTCTTTTCTATGGTT
AAGTTCATGTCATAGGAAGGGGAGAAGTAACAGGGTACAGTTTAGAATGG
GAAACAGACGAATGATTGCATCAGTGTGGAAGTCTCAGGATCGTTTTAGT
TTCTTTTATTTGCTGTTCATAACAATTGTTTTCTTTTGTTTAATTCTTGC
TTTCTTTTTTTTTCTTCTCCGCAATTTTTACTATTATACTTAATGCCTTA
ACATTGTGTATAACAAAAGGAAATATCTCTGAGATACATTAAGTAACTTA
AAAAAAAACTTTACACAGTCTGCCTAGTACATTACTATTTGGAATATATG
TGTGCTTATTTGCATATTCATAATCTCCCTACTTTATTTTCTTTTATTTT
TAATTGATACATAATCATTATACATATTTATGGGTTAAAGTGTAATGTTT
TAATATGTGTACACATATTGACCAAATCAGGGTAATTTTGCATTTGTAAT
TTTAAAAAATGCTTTCTTCTTTTAATATACTTTTTTGTTTATCTTATTTC
TAATACTTTCCCTAATCTCTTTCTTTCAGGGCAATAATGATACAATGTAT
CATGCCTCTTTGCACCATTCTAAAGAATAACAGTGATAATTTCTGGGTTA
AGGCAATAGCAATATTTCTGCATATAAATATTTCTGCATATAAATTGTAA
CTGATGTAAGAGGTTTCATATTGCTAATAGCAGCTACAATCCAGCTACCA
TTCTGCTTTTATTTTATGGTTGGGATAAGGCTGGATTATTCTGAGTCCAA
GCTAGGCCCTTTTGCTAATCATGTTCATACCTCTTATCTTCCTCCCACAG
CTCCTGGGCAACGTGCTGGTCTGTGTGCTGGCCCATCACTTTGGCAAAGA
ATTCACCCCACCAGTGCAGGCTGCCTATCAGAAAGTGGTGGCTGGTGTGG
CTAATGCCCTGGCCCACAAGTATCACTAAGCTCGCTTTCTTGCTGTCCAA
TTTCTATTAAAGGTTCCTTTGTTCCCTAAGTCCAACTACTAAACTGGGGG
ATATTATGAAGGGCCTTGAGCATCTGGATTCTGCCTAATAAAAAACATTT
ATTTTCATTGCAATGATGTATTTAAATTATTTCTGAATATTTTACTAAAA
AGGGAATGTGGGAGGTCAGTGCATTTAAAACATAAAGAAATGAAGAGCTA
GTTCAAACCTTGGGAAAATACACTATATCTTAAACTCCATGAAAGAAGGT
GAGGCTGCAAACAGCTAATGCACATTGGCAACAGCCCTGATGCCTATGCC
TTATTCATCCCTCAGAAAAGGA

	A sample protein file:
VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKV
KAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENHFRLLGNVLVCVLAHHFGK
EFTPPVQAAYKVVAGVANALAHKYH
*/

#include   <stdio.h>

#define  DNASIZE       5	/* size of DNA alphabet: A, C, G, T, N */
#define  AASIZE       23	/* size of protein alphabet */
#define  DNAS2  (DNASIZE * DNASIZE) /* DNASIZE square */
#define  DNAS3  (DNASIZE * DNAS2)   /* DNASIZE cube */
#define  DOUBLE        1	/* 1, both strands; 0, given strand only */
#define  MINF      -10000	/* negative infinity */
#define  BONUS5    3	/* factor, a bonus of 3r for a long gap starting with GT */
#define  BONUS3    3	/* factor, a bonus of 4r for a long gap ending with AG */

static char   aa[AASIZE][4];	/* integer code to three-letter code */
static char   aa2[AASIZE][4];	/* integer code to one-letter code */
static int    w[AASIZE][DNAS3]; /* score table for substitutions */
static int    da[DNAS3];	/* codon integer code to aa integer code */
static int    ai[128];		/* aa letter to integer code */
static int    di[128];		/* DNA letter to integer code */
static int    pam[AASIZE][AASIZE]; /* pam matrix */
static int    nnb[DNASIZE];	/* type 1: b to nnb */
static int    nbn[DNASIZE];	/* type 2: b to nbn */
static int    bnn[DNASIZE];	/* type 3: b to bnn */
static int    nbb[DNAS2];	/* type 4: bb to nbb */
static int    bnb[DNAS2];	/* type 5: bb to bnb */
static int    bbn[DNAS2];	/* type 6: bb to bbn */
/* type 7, bbb; 8, bnbb; 9, bbnb; 10 and 11, bbn...nb; 12 and 13, bn...nbb */
static int    ochre;		/* stop codon code */
static int    amber;		/* stop codon code */
static int    uga;		/* stop codon code */
static int    dnals2;		/* DNASIZE square */
static int    dnals3;		/* DNASIZE cube */
static int    gtcode;		/* the integer code of GT */
static int    agcode;		/* the integer code of AG */
static int    bonus5;		/* BONUS5 times r */
static int    bonus3;		/* BONUS3 times r */
static char   mt1[AASIZE][DNASIZE]; /* patial match indicator for base 1 */
static char   mt2[AASIZE][DNAS2];   /* patial match indicator for base 2 */
static char   mt3[AASIZE][DNAS3];   /* patial match indicator for base 3 */
static int    dnalen;		/* length of DNA sequence */

static int match, mismh;		/* max and min substitution weights */
static char *name1, *name2;		/* names of sequence files    */
static int  q, r;       /* gap penalties */
static int  qr;         /* qr = q + r */
static int  qr2;        /* q + 2 * r */
static int  qr3;        /* q + 3 * r */
static int  q2r2;       /* 2 * q + 2 * r */
static int  r2;         /* 2 * r */
static int  r3;         /* 3 * r */
static int  gaplen;     /* minimum length for constant-cost insertion */
static int  pay;	/* constant-cost for long insertion */

main(argc, argv) int argc; char *argv[];
{ int  M, N;				/* Sequence lengths and k     */
  char *A,  *B;				/* Storing two sequences      */
  int  *AN, *DN;			/* two sequences of integer codes */
  int  symbol;				/* The next character	      */
  int  ms;				/* User-supplied weights      */
  FILE *Bp, *Ap, *Sp, *ckopen();
  char *ckalloc();			/* space-allocating function  */
  register int i, j;
  char  alph[129], *s;			/* alphabet */
  int  size;				/* size of alphabet */

	if ( argc != 7 )
	   fatalf("The proper form of command is: \n%s DNA_Seq Prot_Seq gap-size(>1) mismatch(<0) gap-open(>=0) gap-extend(>0)", argv[0]);

	ComputeAiDi();
	/* determine the sequence lengths */
	Ap = ckopen(argv[1], "r");
	for (M = 0; ( symbol = getc(Ap)) != EOF ; )
	   if ( symbol != '\n' )
	      ++M;
	(void) fclose(Ap);
	name1 = argv[1];

	/* allocate space for A */
	A = ( char * ) ckalloc( (M + 1) * sizeof(char));
	DN = ( int * ) ckalloc( (M + 1) * sizeof(int));
	/* read the first sequence into A */
	Ap = ckopen(argv[1], "r");
	for (M = 0; ( symbol = getc(Ap)) != EOF ; )
	   if ( symbol != '\n' )
	     {	A[++M] = symbol;
	      	DN[M] = di[symbol];
	     }

	/* read the second sequence into B */
	Bp = ckopen(argv[2], "r");
	for (N = 0; ( symbol = getc(Bp)) != EOF ; )
	  if ( symbol != '\n' )
	     ++N;
	(void) fclose(Bp);
	name2 = argv[2];
	B = ( char * ) ckalloc( (N + 1) * sizeof(char));
	AN = ( int * ) ckalloc( (N + 1) * sizeof(int));
	Bp = ckopen(argv[2], "r");
	for (N = 0; ( symbol = getc(Bp)) != EOF ; )
	   if ( symbol != '\n' )
	     {  B[++N] = symbol;
	      	AN[N] = ai[symbol];
	     }

	if ( M == 0 && N == 0 )
	   fatal("Both sequences are empty");
	(void) sscanf(argv[3],"%d", &gaplen);
	if ( gaplen < 5 )
	   fatal("The minimum length for constant-cost insertion is 5");

	(void) sscanf(argv[argc-2],"%d", &q);
	if ( q < 0 )
	   fatal("The gap-open penalty is a nonnegative integer");

	(void) sscanf(argv[argc-1],"%d", &r);
	if ( r < 0 )
	   fatal("The gap-extend penalty is a nonnegative integer");

	pay = q + r * gaplen;
	qr = q + r;
	r2 = 2 * r;
	r3 = 3 * r;
	qr2 = q + r2;
	qr3 = q + r3;
	q2r2 = 2 * q + r2;

	/* check if the argument represents a negative integer */
	s = argv[argc-3];
	if ( *s == '-' ) s++;
	for ( ; *s >= '0' && *s <= '9' ; s++ );
	if ( *s == '\0' )
	  { (void) sscanf(argv[argc-3],"%d", &ms);
	    if ( ms >= 0 )
	       fatal("The mismatch weight is a negative integer");
	    match = 10;
	    mismh = ms;
	    /* set match and mismatch weights */
	    for ( i = 0; i < AASIZE ; i++ )
	      for ( j = 0; j < AASIZE ; j++ )
	         if (i == j )
	            pam[i][j] = 10;
	         else
	            pam[i][j] = mismh;
	  }
	else
	  { /* read a file containing alphabet and substitution weights */
	    Sp = ckopen(argv[argc-3], "r");
	    (void) fscanf(Sp, "%s", alph);
	    size = strlen(alph);
	    match = mismh = 0;
	    /* Initialize pam[][] */
	    for ( i = 0; i < AASIZE ; i++ )
	      for ( j = 0; j < AASIZE ; j++ )
	            pam[i][j] = 0;
	    for ( i = 0; i < size ; i++ )
	      for ( j = 0; j <= i ; j++ )
		{ (void) fscanf(Sp, "%d", &ms);
		  pam[ai[alph[i]]][ai[alph[j]]] = pam[ai[alph[j]]][ai[alph[i]]] = ms;
		  if ( ms > match ) match = ms;
		  if ( ms < mismh ) mismh = ms;
		}
	  }
	ComputeDa();
	SetUpW();
	SetUpMt();
	ComputeAa();
	LOCAL(B,A,N,M,AN,DN);
}

static int *CC, *PC, *DD;		/* saving matrix scores */
static int *RR, *SS;		 	/* for reverse pass */
static int *S;				/* saving operations for diff3 */
static int *ST;				/* saving substitution types */

/* The following definitions are for function diff3() */

int  diff3();
static int  zero = 0;				/* int type zero        */

#define gap(k)  ((k) <= 0 ? 0 : q+r*(k))	/* k-symbol indel score */

#define gap2(k)  ((k) <= 0 ? 0 : ((k) <= gaplen ? q+r*(k) : pay))
/* k-symbol insertion score */

static int *sapp;				/* Current script append ptr */
static int *stptr;				/* Substitution type ptr */
static int  last;				/* Last script op appended */

static int no_mat; 				/* number of matches */ 
static int no_mis; 				/* number of mismatches */ 
static int no_gap; 				/* number of indels */
						/* Append "Delete k" op */
#define DEL(k)				\
{ no_gap += (3 * (k));			\
  if (last < 0)				\
    last = sapp[-1] -= (k);		\
  else					\
    last = *sapp++ = -(k);		\
}
						/* Append "Insert k" op */
#define INS(k)				\
{ no_gap += (k);			\
  if (last > 0)				\
    last = sapp[-1] += (k);		\
  else					\
    last = *sapp++ = (k);		\
}
						/* Append "Replace" op */
#define REP(t) 				\
{ last = *sapp++ = 0; 			\
  *stptr++ = (t);                       \
}

ComputeAiDi()
{ int i;

	for ( i = 0; i < 128; i++ )
	 { di[i] = DNASIZE - 1; 	/* code of 'N' */
	   ai[i] = AASIZE - 1;	 	/* code of 'X' */
	 }
	di['a'] = di['A'] = 0;
	di['c'] = di['C'] = 1;
	di['g'] = di['G'] = 2;
	di['t'] = di['T'] = 3;
	di['n'] = di['N'] = 4;

	ai['a'] = ai['A'] = 0;
	ai['r'] = ai['R'] = 1;
	ai['n'] = ai['N'] = 2;
	ai['d'] = ai['D'] = 3;
	ai['c'] = ai['C'] = 4;
	ai['q'] = ai['Q'] = 5;
	ai['e'] = ai['E'] = 6;
	ai['g'] = ai['G'] = 7;
	ai['h'] = ai['H'] = 8;
	ai['i'] = ai['I'] = 9;
	ai['l'] = ai['L'] = 10;
	ai['k'] = ai['K'] = 11;
	ai['m'] = ai['M'] = 12;
	ai['f'] = ai['F'] = 13;
	ai['p'] = ai['P'] = 14;
	ai['s'] = ai['S'] = 15;
	ai['t'] = ai['T'] = 16;
	ai['w'] = ai['W'] = 17;
	ai['y'] = ai['Y'] = 18;
	ai['v'] = ai['V'] = 19;
	ai['b'] = ai['B'] = 20;
	ai['z'] = ai['Z'] = 21;
	ai['x'] = ai['X'] = 22;
}

/* Compute the da table */
ComputeDa()
{ int  i;	/* index variable */
  int  b;	/* one-symbol integer code */
  int  bb;	/* two-symbol integer code */
	
	dnals3 = (dnals2 = DNAS2) * DNASIZE;
	for ( i = 0; i < dnals3; i++ )
	  da[i] = AASIZE - 1;
	b = di['A'] * dnals2;
	bb = b + di['A'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 11;
	da[bb + di['C']] = da[bb + di['T']] = 2;
	bb = b + di['C'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 16;
	da[bb + di['C']] = da[bb + di['T']] = 16;
	bb = b + di['G'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 1;
	da[bb + di['C']] = da[bb + di['T']] = 15;
	bb = b + di['T'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['C']] = da[bb + di['T']] = 9;
	da[bb + di['G']] = 12;

	b = di['C'] * dnals2;
	bb = b + di['A'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 5;
	da[bb + di['C']] = da[bb + di['T']] = 8;
	bb = b + di['C'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 14;
	da[bb + di['C']] = da[bb + di['T']] = 14;
	bb = b + di['G'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 1;
	da[bb + di['C']] = da[bb + di['T']] = 1;
	bb = b + di['T'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 10;
	da[bb + di['C']] = da[bb + di['T']] = 10;

	b = di['G'] * dnals2;
	bb = b + di['A'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 6;
	da[bb + di['C']] = da[bb + di['T']] = 3;
	bb = b + di['C'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 0;
	da[bb + di['C']] = da[bb + di['T']] = 0;
	bb = b + di['G'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 7;
	da[bb + di['C']] = da[bb + di['T']] = 7;
	bb = b + di['T'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 19;
	da[bb + di['C']] = da[bb + di['T']] = 19;

	b = di['T'] * dnals2;
	bb = b + di['A'] * DNASIZE;
	da[ochre = bb + di['A']] = da[amber = bb + di['G']] = AASIZE;
	da[bb + di['C']] = da[bb + di['T']] = 18;
	bb = b + di['C'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 15;
	da[bb + di['C']] = da[bb + di['T']] = 15;
	bb = b + di['G'] * DNASIZE;
	da[uga = bb + di['A']] = AASIZE;
	da[bb + di['G']] = 17;
	da[bb + di['C']] = da[bb + di['T']] = 4;
	bb = b + di['T'] * DNASIZE;
	da[bb + di['A']] = da[bb + di['G']] = 10;
	da[bb + di['C']] = da[bb + di['T']] = 13;
	gtcode = di['G'] * DNASIZE + di['T'];
	agcode = di['A'] * DNASIZE + di['G'];
	bonus5 = BONUS5 * r;
	bonus3 = BONUS3 * r;
}

/* Set up w, bbn, bnb, nbb, bnn, nbn, nnb */
SetUpW()
{ int  i, j, k;	/* index varialbes */
  int  row;	/* row number of w */
  int  *wa;	/* row of w */
  int  *va;	/* row of v */
  int  b;	/* one-symbol integer code */
  int  bb;	/* two-symbol integer code */
  int  bbb;	/* three-symbol integer code */
  int  ci;	/* number of codons in the i-indexed loop */
  int  si;	/* sum of substitution scores in the i-indexed loop */
  int  cj;	/* number of codons in the j-indexed loop */
  int  sj;	/* sum of substitution scores in the j-indexed loop */
  int  ck;	/* number of codons in the k-indexed loop */
  int  sk;	/* sum of substitution scores in the k-indexed loop */
  int  s;	/* substitution score */
  int  ds1;	/* DNASIZE -1 */
  int  x;	/* index for bbn, bnb, nbb */
  int  NXX, XNX, NNX, NXN, XNN;	/* constants */	
	

	ds1 = DNASIZE - 1;
	NXX = ds1 * dnals2;
	XNX = ds1 * DNASIZE;
	NNX = NXX + XNX;
	NXN = NXX + ds1; 
	XNN = XNX + ds1;
	/* Set up bbn, bnb, nbb, bnn, nbn, nnb */
	for ( i = 0; i < DNASIZE; i++ )
	 { bnn[i] = i * dnals2 + XNN; 
	   b = i * DNASIZE;
	   for ( j = 0; j < DNASIZE; j++ )
	    { bbb = (x = b + j) * DNASIZE + ds1;
	      bbn[x] = bbb; 
	    }
	 }
	for ( k = 0; k < DNASIZE; k++ )
	 { nnb[k] = NNX + k; 
	   for ( j = 0; j < DNASIZE; j++ )
	    { x = j * DNASIZE + k; 
	      nbb[x] = NXX + x;
	    }
	 }
	for ( j = 0; j < DNASIZE; j++ )
	   nbn[j] = NXN + j * DNASIZE; 
	for ( i = 0; i < DNASIZE; i++ )
	 { b = i * dnals2;
	   x = i * DNASIZE;
	   for ( k = 0; k < DNASIZE; k++ )
	      bnb[x + k] = b + XNX + k;
	 }
	/* compute the substitution scores for ijk, ij'N' and i'N''N' */
	for ( row = 0; row < AASIZE; row++ )
	 { wa = w[row];
	   va = pam[row];
	   for ( i = 0; i < ds1; i++ )
	    { b = i * DNASIZE;
	      for ( sj = cj = j = 0; j < ds1; j++ )
	       { bb = (b + j) * DNASIZE;
		 for ( sk = ck = k = 0; k < ds1; k++ )
		  { bbb = bb + k;
		    if ( da[bbb] != AASIZE )
		     { s = wa[bbb] = va[da[bbb]];
		       sk += s;
		       sj += s;
		       cj++;
		       ck++;
		     }
		  }
		 bbb = bb + ds1;
		 wa[bbb] = ck > 0 ? (sk / ck) : 0;
	       }
              bbb = (b + ds1) * DNASIZE + ds1;
              wa[bbb] = cj > 0 ? (sj / cj) : 0;
	    }
	 }
	for ( row = 0; row < AASIZE; row++ )
	 { wa = w[row];
	   /* compute the substitution scores for 'N'jk and 'N''N'k */
	   for ( k = 0; k < ds1; k++ )
	    { for ( sj = cj = j = 0; j < ds1; j++ )
	       { bb = j * DNASIZE + k;
		 for ( si = ci = i = 0; i < ds1; i++ )
		  { bbb = i * dnals2 + bb;
		    if ( da[bbb] != AASIZE )
		     { si += (s = wa[bbb]);
		       sj += s;
		       ci++;
		       cj++;
		     }
		  }
		 bbb = NXX + bb;
		 wa[bbb] = ci > 0 ? (si / ci) : 0;
	       }
              bbb = NNX + k;
              wa[bbb] = cj > 0 ? (sj / cj) : 0;
	    }
	   /* compute the substitution scores for 'N'j'N' */
	   for ( j = 0; j < ds1; j++ )
	    { b = j * DNASIZE;
	      for ( si = ci = i = 0; i < ds1; i++ )
	       { bb = i * dnals2 + b;
		 for ( k = 0; k < ds1; k++ )
		  { bbb = bb + k;
		    if ( da[bbb] != AASIZE )
		     { si += wa[bbb];
		       ci++;
		     }
		  }
	       }
              bbb = NXN + b;
              wa[bbb] = ci > 0 ? (si / ci) : 0;
	    }
	   /* compute the substitution scores for i'N'k */
	   for ( i = 0; i < ds1; i++ )
	    { b = i * dnals2;
	      for ( k = 0; k < ds1; k++ )
	       { bb = b + k;
		 for ( sj = cj = j = 0; j < ds1; j++ )
		  { bbb = bb + j * DNASIZE;
		    if ( da[bbb] != AASIZE )
		     { sj += wa[bbb];
		       cj++;
		     }
		  }
                 bbb = b + XNX + k;
                 wa[bbb] = cj > 0 ? (sj / cj) : 0;
	       }
	    }
           wa[NXX + XNN] = 0;
	   /* compute the substitution scores for stop codons */
           wa[ochre] = mismh;
           wa[amber] = mismh;
           wa[uga] = mismh;
	 }
}

/* Set up mt1, mt2 and mt3. */
SetUpMt()
{ int  i, j, k;	/* index varialbes */
  int  row;	/* row number of w */
  char *mr1;	/* row of mt1 */
  char *mr2;	/* row of mt2 */
  char *mr3;	/* row of mt3 */
  int  b;	/* one-symbol integer code */
  int  bb;	/* two-symbol integer code */
  int  bbb;	/* three-symbol integer code */
	
	/* set all mt to a blank */
	for ( row = 0; row < AASIZE; row++ )
	 { mr1 = mt1[row];
	   mr2 = mt2[row];
	   mr3 = mt3[row];
	   for ( i = 0; i < DNASIZE; i++ )
	    { mr1[i] = ' ';
	      b = i * DNASIZE;
	      for ( j = 0; j < DNASIZE; j++ )
	       { mr2[bb = b+j] = ' ';
		 bbb = bb * DNASIZE;
		 for ( k = 0; k < DNASIZE; k++ )
	            mr3[bbb + k] = ' ';
	       }
	    }
	 }
	mt1[ai['A']][di['G']] = '.';
	mt1[ai['R']][di['A']] = '.';
	mt1[ai['R']][di['C']] = '.';
	mt1[ai['N']][di['A']] = '.';
	mt1[ai['D']][di['G']] = '.';
	mt1[ai['C']][di['T']] = '.';
	mt1[ai['Q']][di['C']] = '.';
	mt1[ai['E']][di['G']] = '.';
	mt1[ai['G']][di['G']] = '.';
	mt1[ai['H']][di['C']] = '.';
	mt1[ai['I']][di['A']] = '.';
	mt1[ai['L']][di['C']] = '.';
	mt1[ai['L']][di['T']] = '.';
	mt1[ai['K']][di['A']] = '.';
	mt1[ai['M']][di['A']] = '.';
	mt1[ai['F']][di['T']] = '.';
	mt1[ai['P']][di['C']] = '.';
	mt1[ai['S']][di['A']] = '.';
	mt1[ai['S']][di['T']] = '.';
	mt1[ai['T']][di['A']] = '.';
	mt1[ai['W']][di['T']] = '.';
	mt1[ai['Y']][di['T']] = '.';
	mt1[ai['V']][di['G']] = '.';
	mt1[ai['B']][di['A']] = '.';
	mt1[ai['B']][di['G']] = '.';
	mt1[ai['Z']][di['C']] = '.';
	mt1[ai['Z']][di['G']] = '.';
	for ( i = 0; i < DNASIZE; i++ )
	 { b = i * DNASIZE;
	   mt2[ai['A']][b + di['C']] = '.';
	   mt2[ai['R']][b + di['G']] = '.';
	   mt2[ai['N']][b + di['A']] = '.';
	   mt2[ai['D']][b + di['A']] = '.';
	   mt2[ai['C']][b + di['G']] = '.';
	   mt2[ai['Q']][b + di['A']] = '.';
	   mt2[ai['E']][b + di['A']] = '.';
	   mt2[ai['G']][b + di['G']] = '.';
	   mt2[ai['H']][b + di['A']] = '.';
	   mt2[ai['I']][b + di['T']] = '.';
	   mt2[ai['L']][b + di['T']] = '.';
	   mt2[ai['K']][b + di['A']] = '.';
	   mt2[ai['M']][b + di['T']] = '.';
	   mt2[ai['F']][b + di['T']] = '.';
	   mt2[ai['P']][b + di['C']] = '.';
	   if ( i != di['A'] )
	     mt2[ai['S']][b + di['C']] = '.';
	   if ( i != di['T'] )
	     mt2[ai['S']][b + di['G']] = '.';
	   mt2[ai['T']][b + di['C']] = '.';
	   mt2[ai['W']][b + di['G']] = '.';
	   mt2[ai['Y']][b + di['A']] = '.';
	   mt2[ai['V']][b + di['T']] = '.';
	   mt2[ai['B']][b + di['A']] = '.';
	   mt2[ai['Z']][b + di['A']] = '.';
	   for ( j = 0; j < DNASIZE; j++ )
	    { bb = (b + j) * DNASIZE;
	      mr3 = mt3[ai['A']];
	      mr3[bb + di['A']] = mr3[bb + di['C']] = mr3[bb + di['G']] = '.';
	      mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['R']];
	      mr3[bb + di['A']] = mr3[bb + di['G']] = '.';
	      if ( i != di['A'] )
		mr3[bb + di['C']] = mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['N']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['D']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['C']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['Q']];
	      mr3[bb + di['A']] = mr3[bb + di['G']] = '.';
	      mr3 = mt3[ai['E']];
	      mr3[bb + di['A']] = mr3[bb + di['G']] = '.';
	      mr3 = mt3[ai['G']];
	      mr3[bb + di['A']] = mr3[bb + di['C']] = mr3[bb + di['G']] = '.';
	      mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['H']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['I']];
	      mr3[bb + di['A']] = mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['L']];
	      mr3[bb + di['A']] = mr3[bb + di['G']] = '.';
	      if ( i != di['T'] )
		mr3[bb + di['C']] = mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['K']];
	      mr3[bb + di['A']] = mr3[bb + di['G']] = '.';
	      mr3 = mt3[ai['M']];
	      mr3[bb + di['G']] = '.';
	      mr3 = mt3[ai['F']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['P']];
	      mr3[bb + di['A']] = mr3[bb + di['C']] = mr3[bb + di['G']] = '.';
	      mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['S']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      if ( i != di['A'] && ( i == di['T'] || j != di['G'] ) )
	       mr3[bb + di['A']] = mr3[bb + di['G']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['T']];
	      mr3[bb + di['A']] = mr3[bb + di['C']] = mr3[bb + di['G']] = '.';
	      mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['W']];
	      mr3[bb + di['G']] = '.';
	      mr3 = mt3[ai['Y']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['V']];
	      mr3[bb + di['A']] = mr3[bb + di['C']] = mr3[bb + di['G']] = '.';
	      mr3[bb + di['T']] = mr3[bb + di['N']] = '.';
	      mr3 = mt3[ai['B']];
	      mr3[bb + di['C']] = mr3[bb + di['T']] = '.';
	      mr3 = mt3[ai['Z']];
	      mr3[bb + di['A']] = mr3[bb + di['G']] = '.';
	    }
	 }
}

ComputeAa()
{  int strcpy();
  	strcpy(aa[0], "Ala");
	strcpy(aa[1], "Arg");
	strcpy(aa[2], "Asn");
	strcpy(aa[3], "Asp");
	strcpy(aa[4], "Cys");
	strcpy(aa[5], "Gln");
	strcpy(aa[6], "Glu");
	strcpy(aa[7], "Gly");
	strcpy(aa[8], "His");
	strcpy(aa[9], "Ile");
	strcpy(aa[10], "Leu");
	strcpy(aa[11], "Lys");
	strcpy(aa[12], "Met");
	strcpy(aa[13], "Phe");
	strcpy(aa[14], "Pro");
	strcpy(aa[15], "Ser");
	strcpy(aa[16], "Thr");
	strcpy(aa[17], "Trp");
	strcpy(aa[18], "Tyr");
	strcpy(aa[19], "Val");
	strcpy(aa[20], "Asx");
	strcpy(aa[21], "Glx");
	strcpy(aa[22], "Xxx");

  	strcpy(aa2[0], " A ");
	strcpy(aa2[1], " R ");
	strcpy(aa2[2], " N ");
	strcpy(aa2[3], " D ");
	strcpy(aa2[4], " C ");
	strcpy(aa2[5], " Q ");
	strcpy(aa2[6], " E ");
	strcpy(aa2[7], " G ");
	strcpy(aa2[8], " H ");
	strcpy(aa2[9], " I ");
	strcpy(aa2[10], " L ");
	strcpy(aa2[11], " K ");
	strcpy(aa2[12], " M ");
	strcpy(aa2[13], " F ");
	strcpy(aa2[14], " P ");
	strcpy(aa2[15], " S ");
	strcpy(aa2[16], " T ");
	strcpy(aa2[17], " W ");
	strcpy(aa2[18], " Y ");
	strcpy(aa2[19], " V ");
	strcpy(aa2[20], " B ");
	strcpy(aa2[21], " Z ");
	strcpy(aa2[22], " X ");
}

/* Determines the location of an optimal local alignment
   and constructs the alignment in linear space          */
LOCAL(A,B,M,N,AN,DN) char A[],B[]; int M,N, AN[], DN[];
{ int  score;   		/* the alignment score */
  int  i, j;			/* row and column indices */
  char *ckalloc();		/* space-allocating function */
  int  ss0;			/* score */
  int  *DN0;			/* reverse complement of DN */
  char *B0;			/* reverse complement of B */
  int  orient;			/* orientation */
  int  stari, starj;		/* starting positions */
  int  endi, endj;		/* ending positions */
  int  endi0, endj0;		/* ending positions */
  int  alen, nlen;		/* lengths of two subsequences */
  int  forward(), reverse();
	
	    /* allocate space for all vectors */
	    j = (N + 1) * sizeof(int);
	    CC = ( int * ) ckalloc(j);
	    PC = ( int * ) ckalloc(j);
	    DD = ( int * ) ckalloc(j);
	    RR = ( int * ) ckalloc(j);
	    SS = ( int * ) ckalloc(j);
	    i = (M + 1) * sizeof(int);
	    S = ( int * ) ckalloc(i + j);
	    ST = ( int * ) ckalloc(i + j);
	    if ( DOUBLE )
	     { /* allocate space for B0 */
	       B0 = ( char * ) ckalloc( (N + 1) * sizeof(char));
	       DN0 = ( int * ) ckalloc( (N + 1) * sizeof(int));
	       /* Set B0 and DN0 to the reverse complement of B and DN */
	       for ( i = 1, j = N; i <= N; i++, j-- )
	           switch( DN[i] )
		    { case 0 : DN0[j] = 3;
			      B0[j] = 'T';
			      break;
		      case 1 : DN0[j] = 2;
			      B0[j] = 'G';
			      break;
		      case 2 : DN0[j] = 1;
			      B0[j] = 'C';
			      break;
		      case 3 : DN0[j] = 0;
			      B0[j] = 'A';
			      break;
		      case 4 : DN0[j] = 4;
			      B0[j] = 'N';
			      break;
		      default : break;
		    }
	     }
(void) printf("Max Match   Min Mismatch   Gap-Open Penalty   Gap-Extension Penalty\n");
(void) printf("   %d          %d              %d                  %d\n",
						       match, mismh, q, r);
	    (void) printf("                 Upper Sequence : %s\n", name1);
	    (void) printf("                         Length : %d\n", N);
	    (void) printf("                 Lower Sequence : %s\n", name2);
	    (void) printf("                         Length : %d\n\n", M);
	    orient = 1;
	    forward(AN,DN,M,N,&score,&endi,&endj);
	    if ( DOUBLE )
	     { ss0 = score;
	       endi0 = endi;
	       endj0 = endj;
	       forward(AN,DN0,M,N,&score,&endi,&endj);
	       if ( score <= ss0 )
		{ endi = endi0;
                  endj = endj0;
		  score = ss0;
		}
	       else
		  orient = 0;
	     }
            if ( score <= 0 )
	     { (void) printf("No local alignment of positive score is found\n");
	       return;
	     }
	    if ( orient )
              ss0 = reverse(AN,DN,endi,endj,&score,&stari,&starj);
	    else
              ss0 = reverse(AN,DN0,endi,endj,&score,&stari,&starj);
	    if ( ss0 == 0 )
	     { (void) printf("No local alignment of score > 0 is found by reverse()\n");
	       return;
	     }
	    ss0 = score;
            alen = endi - stari;
            nlen = endj - starj;
            sapp = S;
	    stptr = ST;
            last = 0;
            no_gap = 0;
            no_mat = 0;
	    no_mis = 0;
	    if ( orient )
	       score = diff3(AN+stari,DN+starj,alen,nlen,q,q,1,1,1,1);
	    else
	       score = diff3(AN+stari,DN0+starj,alen,nlen,q,q,1,1,1,1);

            /* Output the best alignment */
            (void) printf("      Best Local Alignment\n");
            (void) printf("      Similarity Score : %d\n",score);
	    if ( alen > 0 )
            (void) printf("      Match Percentage : %d%%\n", (100*no_mat)/alen);
            (void) printf("      Number of Matches : %d\n", no_mat);
            (void) printf("      Number of Mismatches : %d\n", no_mis);
            (void) printf("      Total Length of Gaps : %d\n", no_gap);
	    if ( orient )
	     { (void) printf("      DNA Strand : plus \n");
               (void) printf("      Begins at (%d, %d) and Ends at (%d, %d)\n",
				    starj+1,stari+1, endj,endi);
	     }
	    else
	     { (void) printf("      DNA Strand : minus \n");
               (void) printf("      Begins at (%d, %d) and Ends at (%d, %d)\n",
				    N-starj, stari+1, N-endj+1, endi);
	     }
            dnalen = N;
	    if ( orient )
	     { display(A+stari,B+starj,alen,nlen,AN+stari,DN+starj,S,ST,
		       stari+1,starj+1,orient,aa);
               (void) printf("\nAlternative Display\n");
	       display(A+stari,B+starj,alen,nlen,AN+stari,DN+starj,S,ST,
		       stari+1,starj+1,orient,aa2);
	     }
            else
	     { display(A+stari,B0+starj,alen,nlen,AN+stari,DN0+starj,S,ST,
		       stari+1,starj+1,orient,aa);
               (void) printf("\nAlternative Display\n");
	       display(A+stari,B0+starj,alen,nlen,AN+stari,DN0+starj,S,ST,
		       stari+1,starj+1,orient,aa2);
             }
}

/* It computes the ending point of an optimal local alignment, and
   returns the score in *sp, row number in *sip and column number in *sjp */
   
int forward(AN,DN,M,N,sp,sip,sjp)
int *AN, *DN; int M, N; int *sp, *sip, *sjp;
{ register int  i, j;		/* index variables */
  register int  c;		/* C(i, j) */
  register int  e;		/* E(i, j) */
  register int  d;		/* D(i, j) */
  register int  g;		/* G(i, j) */
  register int  s1;		/* C(i-1, j-1) */
  register int  s2;		/* C(i-1, j-2) */
  register int  s3;		/* C(i-1, j-3) */
  register int  s4;		/* C(i-1, j-4) */
  register int  f1;		/* D(i-1, j-1) */
  register int  f2;		/* D(i-1, j-2) */
           int  *wa;		/* one row of w */
	   int  temp;		/* temp variable */
  	   char *ckalloc();
	   int  b;		/* one-symbol integer code */
	   int  bb;		/* two-symbol integer code */
	   int  bbb;		/* three-symbol integer code */
	   int  bdbb;		/* integer code of bbb */
	   int  bbdb;		/* integer code of bbb */
	   int  x, y, z;	/* temp variables */
	   int  ds;		/* D(i, j) */
	   int  dp;		/* starting position for ds */
	   int  hs1;		/* H(i, j) */
	   int  hp1;		/* starting position for hs1 */
	   int  hs2;		/* H'(i, j) */
	   int  hp2;		/* starting position for hs2 */

  CC[0] = PC[0] = *sp = *sip = *sjp = 0;
  for (j = 1; j <= N; j++)
    { CC[j] = 0;
      DD[j] = -q;
    }
  s2 = s3 = s4 = f2 = 0;
  for (i = 1; i <= M; i++)
    { s1 = f1 = c = 0;
      e = -q;
      g = -pay;
      wa = w[AN[i]];
      ds = hs1 = hs2 = MINF;
      dp = hp1 = hp2 = -1;
      for (j = 1; j <= N; j++)
	{ b = DN[j];
          if ( j > 1 ) bb = DN[j-1] * DNASIZE + b;
	  if ((c = c - qr) > (e = e - r)) e = c;
	  if ((c = CC[j] - qr3) > (d = DD[j] - r3)) d = c;
	  if ((c = f1 + (y = wa[nbn[b]]) - qr2) > d ) d = c;
	  if ((x = wa[bnn[b]] - qr2) > (y = y - q2r2 ) ) y = x;
	  if ((c = s1 + y) > d ) d = c;
	  if ( j > 1 && (c = s2 + wa[bbn[bb]] - qr) > d ) d = c;
	  x = wa[nnb[b]] - r2;
	  if ( (y = f1 + x) > (c = s1 + x - q) ) c = y;
	  if ( c < 0 ) c = 0;
	  if ( j > 1 )
	   { if ((x = wa[nbb[bb]]) > (y = wa[bnb[bb]]) ) y = x;
	     if ( (y = s2 + y - qr) > c ) c = y;
	     if ( (y = f2 + x - r) > c ) c = y;
             if ( j > 2 )
	      { bbb = DN[j-2] * dnals2 + bb;
                if ( (x = s3 + wa[bbb]) > c ) c = x;
		if ( j > 3 )
		 { bdbb = (y = DN[j-3] * dnals2) + bb;
		   bbdb = y + DN[j-2] * DNASIZE + b;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
                   if ( (x = s4 + y - qr) > c ) c = x;
		   if ( ( x = s4 - qr ) > ( ds = ds - r ) )
		    { ds = x;
		      dp = j - 3;
		    }
		   bdbb = (y = DN[dp] * dnals2) + bb;
		   bbdb = y + DN[dp+1] * DNASIZE + b;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
		   if ( (x = ds + y) > c ) c = x;
		 }
	      }
	   }
          if (c < d) c = d;
          if (c < e) c = e;
	  if ( (z = j - gaplen - 1) >= 0 )
	    { x = gtcode == (DN[z+1] * DNASIZE + DN[z+2]) ? bonus5 : 0;
	      if ( g < ( temp = CC[z] + x - pay ) )
		g = temp;
	      x = agcode == bb ? bonus3 : 0;
	      if ( c < (y = g + x) ) c = y;
	      if ( (z = z - 3) >= 0 )
	       { x = gtcode == (DN[z+2] * DNASIZE + DN[z+3]) ? bonus5 : 0;
		 if ( (y = x + (temp = PC[z] - pay) ) > hs1 )
		  { hs1 = y;
		    hp1 = z + 1;
                  }
		 bdbb = DN[hp1] * dnals2 + bb;
	         x = agcode == (DN[j-3] * DNASIZE + DN[j-2]) ? bonus3 : 0;
		 if ( (y = hs1 + x + wa[bdbb]) > c ) c = y;
	         x = gtcode == (DN[z+3] * DNASIZE + DN[z+4]) ? bonus5 : 0;
		 if ( (y = x + temp) > hs2 )
		  { hs2 = y;
		    hp2 = z + 1;
                  }
		 bbdb = DN[hp2] * dnals2 + DN[hp2+1] * DNASIZE + b;
	         x = agcode == (DN[j-2] * DNASIZE + DN[j-1]) ? bonus3 : 0;
		 if ( (y = hs2 + x + wa[bbdb]) > c ) c = y;
               }
	    }
	  s4 = s3;
	  s3 = s2;
	  s2 = s1;
          s1 = PC[j] = CC[j];
          CC[j] = c;
	  f2 = f1;
          f1 = DD[j];
          DD[j] = d;
	  if ( c > *sp )
	   { *sp =  c;
	     *sip = i;
	     *sjp = j;
	   }
        }
    }
}

/* It computes the starting point of an optimal local alignment, and
   returns the score in *sp, row number in *sip and column number in *sjp */
   
int reverse(AN,DN,M,N,sp,sip,sjp)
int *AN, *DN; int M, N; int *sp, *sip, *sjp;
{ register int  i, j;		/* index variables */
  register int  c;		/* C(i, j) */
  register int  e;		/* E(i, j) */
  register int  d;		/* D(i, j) */
  register int  g;		/* G(i, j) */
  register int  s1;		/* C(i-1, j-1) */
  register int  s2;		/* C(i-1, j-2) */
  register int  s3;		/* C(i-1, j-3) */
  register int  s4;		/* C(i-1, j-4) */
  register int  f1;		/* D(i-1, j-1) */
  register int  f2;		/* D(i-1, j-2) */
           int  *wa;		/* one row of w */
	   int  temp;		/* temp variable */
  	   char *ckalloc();
	   int  b;		/* one-symbol integer code */
	   int  bb;		/* two-symbol integer code */
	   int  bbb;		/* three-symbol integer code */
	   int  bj;		/* bbb at midj */
	   int  bdbb;		/* integer code of bbb */
	   int  bbdb;		/* integer code of bbb */
	   int  x, y, z;	/* temp variables */
	   int  ds;		/* D(i, j) */
	   int  dp;		/* starting position for ds */
	   int  hs1;		/* H(i, j) */
	   int  hp1;		/* starting position for hs1 */
	   int  hs2;		/* H'(i, j) */
	   int  hp2;		/* starting position for hs2 */
	   int  cmax;		/* current maximum score */

  RR[N] = PC[N] = cmax = 0;
  for (j = N-1; j >= 0; j--)
    { RR[j] = 0;
      SS[j] = -q;
    }
  s2 = s3 = s4 = f2 = 0;
  for (i = M-1; i >= 0; i--)
    { s1 = f1 = c = 0;
      g = -pay;
      e = -q;
      wa = w[AN[i+1]];
      ds = hs1 = hs2 = MINF;
      dp = hp1 = hp2 = -1;
      for (j = N-1; j >= 0; j--)
        { b = DN[j+1];
	  if ( j < N-1 ) bb = b * DNASIZE + DN[j+2];
          if ((c = c - qr) > (e = e - r)) e = c;
	  if ((c = RR[j] - qr3) > (d = SS[j] - r3)) d = c;
	  if ((c = f1 + (y = wa[nbn[b]]) - qr2) > d ) d = c;
	  if ((x = wa[nnb[b]] - qr2) > (y = y - q2r2 ) ) y = x;
	  if ((c = s1 + y) > d ) d = c;
	  if ( j < (N-1) && (c = s2 + wa[nbb[bb]] - qr) > d ) d = c;
	  x = wa[bnn[b]] - r2;
	  if ( (y = f1 + x) > (c = s1 + x - q) ) c = y;
	  if ( c < 0 ) c = 0;
	  if ( j < N - 1 )
	   { if ((x = wa[bbn[bb]]) > (y = wa[bnb[bb]]) ) y = x;
	     if ( (y = s2 + y - qr) > c ) c = y;
	     if ( (y = f2 + x - r) > c ) c = y;
             if ( j < N - 2 )
	      { bbb = bb * DNASIZE + DN[j+3];
                if ( (x = s3 + wa[bbb]) > c ) c = x;
		if ( j < N - 3 )
		 { bdbb = (z = b * dnals2) + DN[j+3] * DNASIZE + (bj = DN[j+4]);
		   bbdb = (temp = bb * DNASIZE) + bj;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
                   if ( (x = s4 + y - qr) > c ) c = x;
		   if ( ( x = s4 - qr ) > ( ds = ds - r ) )
		    { ds = x;
		      dp = j + 4;
		    }
		   bdbb = z + DN[dp-1] * DNASIZE + (x = DN[dp]);
		   bbdb = temp + x;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
                   if ( (x = ds + y) > c ) c = x;
		 }
	      }
	   }
          if (c < d) c = d;
          if (c < e) c = e;
	  if ( (z = j + gaplen + 1) <= N )
	    { x = agcode == (DN[z-1] * DNASIZE + DN[z]) ? bonus3 : 0;
	      if ( g < ( temp = RR[z] + x - pay ) )
		g = temp;
	      x = gtcode == bb ? bonus5 : 0;
	      if ( c < (y = g + x) ) c = y;
	      if ( (z = z + 3) <= N )
	       { x = agcode == (DN[z-2] * DNASIZE + DN[z-1]) ? bonus3 : 0;
		 if ( (y = x + (temp = PC[z] - pay) ) > hs1 )
		  { hs1 = y;
		    hp1 = z;
                  }
		 bbdb =  bb * DNASIZE + DN[hp1];
	         x = gtcode == (DN[j+3] * DNASIZE + DN[j+4]) ? bonus5 : 0;
                 if ( (y = hs1 + x + wa[bbdb]) > c ) c = y;
	         x = agcode == (DN[z-3] * DNASIZE + DN[z-2]) ? bonus3 : 0;
		 if ( (y = x + temp) > hs2 )
		  { hs2 = y;
		    hp2 = z;
                  }
		 bdbb = b * dnals2 + DN[hp2-1] * DNASIZE + DN[hp2];
	         x = gtcode == (DN[j+2] * DNASIZE + DN[j+3]) ? bonus5 : 0;
                 if ( (y = hs2 + x + wa[bdbb]) > c ) c = y;
               }
	    }
	  s4 = s3;
	  s3 = s2;
	  s2 = s1;
          s1 = PC[j] = RR[j];
          RR[j] = c;
	  f2 = f1;
          f1 = SS[j];
          SS[j] = d;
	  if ( c > cmax )
	   { cmax = c;
             *sip = i;
             *sjp = j;
             if ( c == *sp )
	       return 1;
	   }
        }
    }
   if ( cmax > 0 )
      return 1;
   else
      return 0;
}

/* diff3(AN,DN,M,N,tb,te,sc,sr,ec,er) returns the score of an optimum conversion
   between AN[1..M] and DN[1..N] that begins(ends) with a delete if tb(te) is zero
   and appends such a conversion to the current script. If sc = 0, then
   the beginning deletion is not penalized; if sr = 0, the beginning insertion is
   not penalized; if ec = 0, the ending deletion is not charged; if er = 0;
   then the ending insertion is not charged. Any insertion of length at least
   gaplen is given a constant cost */

int diff3(AN,DN,M,N,tb,te,sc,sr,ec,er)
int *AN, *DN; int M, N; int tb, te, sc, sr, ec, er;

{ int  midi, midj, type;	/* Midpoint, type, and cost */
  int  midc;			/* C(midi, midj) */
  int  ss,cc;			/* terminal gap penalty indicators */

{ register int  i, j;		/* index variables */
  register int  c;		/* C(i, j) */
  register int  e;		/* E(i, j) */
  register int  d;		/* D(i, j) */
  register int  g;		/* G(i, j) */
  register int  s1;		/* C(i-1, j-1) */
  register int  s2;		/* C(i-1, j-2) */
  register int  s3;		/* C(i-1, j-3) */
  register int  s4;		/* C(i-1, j-4) */
  register int  f1;		/* D(i-1, j-1) */
  register int  f2;		/* D(i-1, j-2) */
           int  t;		/* D(i, 0) */
           int  *wa;		/* one row of w */
	   int  temp;		/* temp variable */
  	   char *ckalloc();
	   int  tp;		/* substitution type */
	   int  codl;		/* length of the DNA codon */
	   int  pen;		/* gap penalty */
	   int  b;		/* one-symbol integer code */
	   int  bb;		/* two-symbol integer code */
	   int  bbb;		/* three-symbol integer code */
	   int  bj;		/* bbb at midj */
	   int  bdbb;		/* integer code of bbb */
	   int  bbdb;		/* integer code of bbb */
	   int  x, y, z;	/* temp variables */
	   int  tbsc;		/* tb * sc */
	   int  teec;		/* te * ec */
	   int  ds;		/* D(i, j) */
	   int  dp;		/* starting position for ds */
	   int  hs1;		/* H(i, j) */
	   int  hp1;		/* starting position for hs1 */
	   int  hs2;		/* H'(i, j) */
	   int  hp2;		/* starting position for hs2 */

/* Boundary cases: M <= 1 or N == 0 */

  if (N <= 0)
    { if (M > 0) DEL(M)
      if ( !sc || !ec )
	return 0;
      else
        return - gap(3 * M);
    }
  if (M <= 1)
    { if (M <= 0)
        { INS(N);
          if ( !sr || !er )
    	    return 0;
          else
            return - gap2(N);
        }
      midc = - (sc * (tb + r3) + er * (z = gap2(N) ) );
      midj = -1;
      if ( midc < ( c =  - (ec * (te + r3) + sr * z ) ) )
	{ midc = c;
	  midj = 0;
	}
      tbsc = tb * sc;
      teec = te * ec;
      wa = w[AN[1]];
      ds = hs1 = hs2 = MINF;
      dp = hp1 = hp2 = -1;
      for (j = 1; j <= N; j++)
	{ b = DN[j];
	  y = N - j;
	  temp = er * gap2(y);
	  if ( er && y > gaplen && gtcode == DN[j+1] * DNASIZE + DN[j+2] )
	    temp -= bonus5;
	  y = j - 1;
	  pen = sr * gap2(y) + temp + r2;
	  if ( sr && y > gaplen && agcode == DN[y-1] * DNASIZE + DN[y] )
	    pen -= bonus3;
	  z = j < N ? q : teec;
	  x = y ? q : tbsc;
          if ( (c = wa[nnb[b]] - pen - x) > midc )
           { midc = c;
             midj = j;
	     codl = 1;
	     tp = 1;
           }
          if ( (c = wa[nbn[b]] - pen - x - z) > midc )
           { midc = c;
             midj = j;
	     codl = 1;
	     tp = 2;
           }
          if ( (c = wa[bnn[b]] - pen - z) > midc )
           { midc = c;
             midj = j;
	     codl = 1;
	     tp = 3;
           }
          if ( j > 1 )
	   { bb = DN[j-1] * DNASIZE + b;
	     y = j - 2;
	     pen = sr * gap2(y) + temp + r;
	     if ( sr && y > gaplen && agcode == DN[y-1] * DNASIZE + DN[y] )
	       pen -= bonus3;
	     x = y ? q : tbsc;
             if ( (c = wa[nbb[bb]] - pen - x) > midc )
              { midc = c;
                midj = j;
	        codl = 2;
	        tp = 4;
              }
             if ( (c = wa[bnb[bb]] - pen - q) > midc )
              { midc = c;
                midj = j;
	        codl = 2;
	        tp = 5;
              }
             if ( (c = wa[bbn[bb]] - pen - z) > midc )
              { midc = c;
                midj = j;
	        codl = 2;
	        tp = 6;
              }
             if ( j > 2 )
	      { bbb = DN[j-2] * dnals2 + bb;
		y = j - 3;
	        pen = sr * gap2(y) + temp;
	        if ( sr && y > gaplen && agcode == DN[y-1] * DNASIZE + DN[y] )
	          pen -= bonus3;
                if ( (c = wa[bbb] - pen) > midc )
                 { midc = c;
                   midj = j;
	           codl = 3;
	           tp = 7;
		   bj = bbb;
                 }
		if ( j > 3 )
		 { bdbb = (x = DN[j-3] * dnals2) + bb;
		   y = j - 4;
	           if ( sr && y > gaplen && agcode == DN[y-1] * DNASIZE + DN[y] )
	             pen = (s4 = sr * gap2(y) - bonus3 ) + temp + qr;
		   else
	             pen = (s4 = sr * gap2(y) ) + temp + qr;
                   if ( (c = wa[bdbb] - pen) > midc )
                    { midc = c;
                      midj = j;
	              codl = 4;
	              tp = 8;
                    }
		   bbdb = x + DN[j-2] * DNASIZE + b;
                   if ( (c = wa[bbdb] - pen) > midc )
                    { midc = c;
                      midj = j;
	              codl = 4;
	              tp = 9;
                    }
		   if ( (x = - (s4 + qr) ) > (ds = ds - r) )
		     { ds = x;
		       dp = j - 3;
		     }
		   bbdb = (y = DN[dp] * dnals2) + DN[dp+1] * DNASIZE + b;
		   if ( (c = ds + wa[bbdb] - temp) > midc )
		       { midc = c;
                         midj = j;
	                 codl = j - dp + 1;
	                 tp = 10;
		       }
		   bdbb = y + bb;
		   if ( (c = ds + wa[bdbb] - temp) > midc )
		       { midc = c;
                         midj = j;
	                 codl = j - dp + 1;
	                 tp = 12;
		       }
	           if ( (z = j - gaplen - 4) >= 0 )
	            { x = gtcode == (DN[z+3] * DNASIZE + DN[z+4]) ? bonus5 : 0;
	              if ( (y = x - (s1 = sr * gap2(z) + pay) ) > hs2 )
			 { hs2 = y;
			   hp2 = z + 1;
			 }
		      bbdb = DN[hp2] * dnals2 + DN[hp2+1] * DNASIZE + b;
	              x = agcode == (DN[j-2] * DNASIZE + DN[j-1]) ? bonus3 : 0;
		      if ( (c = hs2 + x + wa[bbdb] - temp) > midc )
		        { midc = c;
                          midj = j;
	                  codl = j - hp2 + 1;
	                  tp = 10;
		        }
	              x = gtcode == (DN[z+2] * DNASIZE + DN[z+3]) ? bonus5 : 0;
	              if ( (y = x - s1 ) > hs1 )
			 { hs1 = y;
			   hp1 = z + 1;
			 }
		      bdbb = DN[hp1] * dnals2 + bb;
	              x = agcode == (DN[j-3] * DNASIZE + DN[j-2]) ? bonus3 : 0;
		      if ( (c = hs1 + x + wa[bdbb] - temp) > midc )
		        { midc = c;
                          midj = j;
	                  codl = j - hp1 + 1;
	                  tp = 12;
		        }
	            }
		 }
	      }
	   }
	}
      if (midj == -1)
        { DEL(1) INS(N) }
      else
      if (midj == 0)
        { INS(N) DEL(1) }
      else
        { if (midj > codl) INS(midj-codl)
          REP(tp)
	  if ( tp > 9 )
	   { INS(codl-3)
             REP(tp+1)
	   }
	  else
	    no_gap += ( z = codl-3 ) >= 0 ? z : (-z);
	  if ( tp == 7 && AN[1] == da[bj] )
	     no_mat += 1;
	  else
	     no_mis += 1;
          if (midj < N) INS(N-midj)
        }
      return midc;
    }

/* Divide: Find optimum midpoint (midi,midj) of cost midc */

  midi = M/2;			/* Forward phase:                          */
  CC[0] = 0;			/*   Compute C(M/2,k) & D(M/2,k) for all k */
  t = - q * sr;
  if ( N <= gaplen )
    for (j = 1; j <= N; j++)
      { CC[j] = t = (t-r) * sr;
        DD[j] = t-q;
      }
  else
   { for (j = 1; j <= gaplen; j++)
      { CC[j] = t = (t-r) * sr;
        DD[j] = t-q;
      }
     x = gtcode == (DN[1] * DNASIZE + DN[2]) ? bonus5 : 0;
     x = (x - pay) * sr;
     for (j = gaplen+1; j <= N; j++)
      { y = (sr && agcode == (DN[j-1] * DNASIZE + DN[j])) ? bonus3 : 0;
        CC[j] = t = x + y;
        DD[j] = t - q;
      }
   }
  if ( !ec ) DD[N] += q;
  t = -tb * sc;
  s2 = s3 = s4 = f2 = 0;
  for (i = 1; i <= midi; i++)
    { s1 = PC[0] = CC[0];
      f1 = t;
      CC[0] = c = t = (t-r3) * sc;
      e = t-q;
      g = t - pay;
      wa = w[AN[i]];
      ds = hs1 = hs2 = t+MINF;
      dp = hp1 = hp2 = -1;
      for (j = 1; j <= N; j++)
	{ b = DN[j];
          if ( j > 1 ) bb = DN[j-1] * DNASIZE + b;
	  if ((c = c - qr) > (e = e - r)) e = c;
	  if ( j == N && !ec )
            { if ((c = CC[j] ) > (d = DD[j] )) d = c;}
	  else
	   { if ((c = CC[j] - qr3) > (d = DD[j] - r3)) d = c;
	     if ((c = f1 + (y = wa[nbn[b]]) - qr2) > d ) d = c;
	     if ((x = wa[bnn[b]] - qr2) > (y = y - q2r2 ) ) y = x;
	     if ((c = s1 + y) > d ) d = c;
	     if ( j > 1 && (c = s2 + wa[bbn[bb]] - qr) > d ) d = c;
	   }
	  x = wa[nnb[b]] - r2;
	  if ( (y = f1 + x) > (c = s1 + x - q) ) c = y;
	  if ( j > 1 )
	   { if ((x = wa[nbb[bb]]) > (y = wa[bnb[bb]]) ) y = x;
	     if ( (y = s2 + y - qr) > c ) c = y;
	     if ( (y = f2 + x - r) > c ) c = y;
             if ( j > 2 )
	      { bbb = DN[j-2] * dnals2 + bb;
                if ( (x = s3 + wa[bbb]) > c ) c = x;
		if ( j > 3 )
		 { bdbb = (y = DN[j-3] * dnals2) + bb;
		   bbdb = y + DN[j-2] * DNASIZE + b;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
                   if ( (x = s4 + y - qr) > c ) c = x;
		   if ( ( x = s4 - qr ) > ( ds = ds - r ) )
		    { ds = x;
		      dp = j - 3;
		    }
		   bdbb = (y = DN[dp] * dnals2) + bb;
		   bbdb = y + DN[dp+1] * DNASIZE + b;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
		   if ( (x = ds + y) > c ) c = x;
		 }
	      }
	   }
          if (c < d) c = d;
          if (c < e) c = e;
	  if ( (z = j - gaplen - 1) >= 0 )
	    { x = gtcode == (DN[z+1] * DNASIZE + DN[z+2]) ? bonus5 : 0;
	      if ( g < ( temp = CC[z] + x - pay ) )
		g = temp;
	      x = agcode == bb ? bonus3 : 0;
	      if ( c < (y = g + x) ) c = y;
	      if ( (z = z - 3) >= 0 )
	       { x = gtcode == (DN[z+2] * DNASIZE + DN[z+3]) ? bonus5 : 0;
		 if ( (y = x + (temp = PC[z] - pay) ) > hs1 )
		  { hs1 = y;
		    hp1 = z + 1;
		  }
		 bdbb = DN[hp1] * dnals2 + bb;
	         x = agcode == (DN[j-3] * DNASIZE + DN[j-2]) ? bonus3 : 0;
		 if ( (y = hs1 + x + wa[bdbb]) > c ) c = y;
	         x = gtcode == (DN[z+3] * DNASIZE + DN[z+4]) ? bonus5 : 0;
		 if ( (y = x + temp) > hs2 )
		  { hs2 = y;
		    hp2 = z + 1;
		  }
		 bbdb = DN[hp2] * dnals2 + DN[hp2+1] * DNASIZE + b;
	         x = agcode == (DN[j-2] * DNASIZE + DN[j-1]) ? bonus3 : 0;
		 if ( (y = hs2 + x + wa[bbdb]) > c ) c = y;
	       }
	    }
	  s4 = s3;
	  s3 = s2;
	  s2 = s1;
          s1 = PC[j] = CC[j];
          CC[j] = c;
	  f2 = f1;
          f1 = DD[j];
          DD[j] = d;
        }
    }
  DD[0] = CC[0];

  RR[N] = 0;			/* Reverse phase:                          */
  t = -q * er;			/*   Compute R(M/2,k) & S(M/2,k) for all k */
  if ( N <= gaplen )
    for (j = N-1; j >= 0; j--)
      { RR[j] = t = (t-r) * er;
        SS[j] = t-q;
      }
  else
   { temp = N - gaplen;
     for (j = N-1; j >= temp; j--)
      { RR[j] = t = (t-r) * er;
        SS[j] = t-q;
      }
     x = agcode == (DN[N-1] * DNASIZE + DN[N]) ? bonus3 : 0;
     x = (x - pay) * er;
     for (j = temp-1; j >= 0; j--)
      { y = (er && gtcode == (DN[j+1] * DNASIZE + DN[j+2]) ) ? bonus5 : 0;
        RR[j] = t = x + y;
        SS[j] = t - q;
      }
   }
  if ( !sc ) SS[0] += q;
  t = -te * ec;
  for (i = M-1; i >= midi; i--)
    { s1 = PC[N] = RR[N];
      f1 = t;
      RR[N] = c = t = (t-r3) * ec;
      g = t - pay;
      e = t-q;
      wa = w[AN[i+1]];
      ds = hs1 = hs2 = t+MINF;
      dp = hp1 = hp2 = -1;
      for (j = N-1; j >= 0; j--)
        { b = DN[j+1];
	  if ( j < N-1 ) bb = b * DNASIZE + DN[j+2];
          if ((c = c - qr) > (e = e - r)) e = c;
	  if ( !j && !sc )
            { if ((c = RR[j] ) > (d = SS[j] )) d = c;}
	  else
	   { if ((c = RR[j] - qr3) > (d = SS[j] - r3)) d = c;
	     if ((c = f1 + (y = wa[nbn[b]]) - qr2) > d ) d = c;
	     if ((x = wa[nnb[b]] - qr2) > (y = y - q2r2 ) ) y = x;
	     if ((c = s1 + y) > d ) d = c;
	     if ( j < (N-1) && (c = s2 + wa[nbb[bb]] - qr) > d ) d = c;
	   }
	  x = wa[bnn[b]] - r2;
	  if ( (y = f1 + x) > (c = s1 + x - q) ) c = y;
	  if ( j < N - 1 )
	   { if ((x = wa[bbn[bb]]) > (y = wa[bnb[bb]]) ) y = x;
	     if ( (y = s2 + y - qr) > c ) c = y;
	     if ( (y = f2 + x - r) > c ) c = y;
             if ( j < N - 2 )
	      { bbb = bb * DNASIZE + DN[j+3];
                if ( (x = s3 + wa[bbb]) > c ) c = x;
		if ( j < N - 3 )
		 { bdbb = (z = b * dnals2) + DN[j+3] * DNASIZE + (bj = DN[j+4]);
		   bbdb = (temp = bb * DNASIZE) + bj;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
                   if ( (x = s4 + y - qr) > c ) c = x;
		   if ( ( x = s4 - qr ) > ( ds = ds - r ) )
		    { ds = x;
		      dp = j + 4;
		    }
		   bdbb = z + DN[dp-1] * DNASIZE + (x = DN[dp]);
		   bbdb = temp + x;
                   if ( (x = wa[bdbb]) > (y = wa[bbdb]) ) y = x;
                   if ( (x = ds + y) > c ) c = x;
		 }
	      }
	   }
          if (c < d) c = d;
          if (c < e) c = e;
	  if ( (z = j + gaplen + 1) <= N )
	    { x = agcode == (DN[z-1] * DNASIZE + DN[z]) ? bonus3 : 0;
	      if ( g < ( temp = RR[z] + x - pay ) )
		g = temp;
	      x = gtcode == bb ? bonus5 : 0;
	      if ( c < (y = g + x) ) c = y;
	      if ( (z = z + 3) <= N )
	       { x = agcode == (DN[z-2] * DNASIZE + DN[z-1]) ? bonus3 : 0;
		 if ( (y = x + (temp = PC[z] - pay) ) > hs1 )
		  { hs1 = y;
		    hp1 = z;
		  }
		 bbdb =  bb * DNASIZE + DN[hp1];
	         x = gtcode == (DN[j+3] * DNASIZE + DN[j+4]) ? bonus5 : 0;
                 if ( (y = hs1 + x + wa[bbdb]) > c ) c = y;
	         x = agcode == (DN[z-3] * DNASIZE + DN[z-2]) ? bonus3 : 0;
		 if ( (y = x + temp) > hs2 )
		  { hs2 = y;
		    hp2 = z;
		  }
		 bdbb = b * dnals2 + DN[hp2-1] * DNASIZE + DN[hp2];
	         x = gtcode == (DN[j+2] * DNASIZE + DN[j+3]) ? bonus5 : 0;
                 if ( (y = hs2 + x + wa[bdbb]) > c ) c = y;
	       }
	    }
	  s4 = s3;
	  s3 = s2;
	  s2 = s1;
          s1 = PC[j] = RR[j];
          RR[j] = c;
	  f2 = f1;
          f1 = SS[j];
          SS[j] = d;
        }
    }
  SS[N] = RR[N];

  midc = CC[0]+RR[0];		/* Find optimal midpoint */
  midj = 0;
  type = 1;
  for (j = 0; j <= N; j++)
    if ((c = CC[j] + RR[j]) >= midc)
      if (c > midc || CC[j] != DD[j] && RR[j] == SS[j])
        { midc = c;
          midj = j;
        }
  for (j = N; j >= 0; j--)
   { if ( j == N )
       d = q * ec;
     else
       if ( j == 0 )
         d = q * sc;
       else
	 d = q;
     if ((c = DD[j] + SS[j] + d) > midc)
       { midc = c;
         midj = j;
         type = 2;
       }
   }
}

/* Conquer: recursively around midpoint */

  cc = midj == N ? ec : 1;
  ss = midj == 0 ? sc : 1;
  if (type == 1)
    { (void) diff3(AN,DN,midi,midj,tb,q,sc,sr,cc,1);
      (void) diff3(AN+midi,DN+midj,M-midi,N-midj,q,te,ss,1,ec,er);
    }
  else
    { (void) diff3(AN,DN,midi,midj,tb,zero,sc,sr,cc,1);
      (void) diff3(AN+midi,DN+midj,M-midi,N-midj,zero,te,ss,1,ec,er);
    }
  return midc;
}

/* Alignment display routine */

static char ALINE[65];	/* protein line */
static char DLINE[65];	/* DNA line */
static char CLINE[65];	/* pair type indicator */ 

display(A,B,M,N,AN,DN,S,ST,AP,DP,orient,ttt)
char A[], B[], (*ttt)[4]; int M, N, AN[], DN[]; int S[], ST[], AP, DP, orient;
{ register char *a;	/* protein line pointer */ 
  register char *d;	/* DNA line pointer */
  register char *c;	/* center line pointer */
  register char *e;	/* temp pointer */
  register int  i, j;	/* index variables */
  register int  op;	/* operation */
           int  lines;	/* line number */
           int  dp;	/* DNA sequence position */
           int  ap;	/* protein sequence position */
	   char *letter;/* pointer to three letter aa string */
	   int  bbb;	/* three-symbol integer code */
           char atemp[5]; /* for suffix of a line of length > 60 */
           char dtemp[5]; /* .. */
           char ctemp[5]; /* .. */
	   int  ls;	/* length of the suffix */
	   int  pst;    /* previous ST value */
   int strcpy();
   int mdp;	/* the DNA position relative to the plus strand */
   int y, z;	/* current nucleotide integer code */
   int one;	/* current amino acid integer code */
   int nx, nxx, nnx;	/* 'N' part in the code */

  i = j = op = lines = 0;
  ap = AP;
  dp = DP;
  a = ALINE;
  d = DLINE;
  c = CLINE;
  pst = 1;
  nx = (DNASIZE - 1) * DNASIZE;
  nxx = nx * DNASIZE;
  nnx = nxx + nx;
  while (i < M || j < N)
    { if (op == 0 && *S == 0)
        { op = *S++;
	  if ( pst != 10 && pst != 12 )
	    letter = ttt[one = AN[++i]];
	  switch ( (pst = *ST++ ) )
	   { case 1 : *d++ = ' ';
	              *d++ = ' ';
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = '-';
		      *c++ = '-';
		      *c++ = mt3[one][nnx + DN[j]];
		      break;
	     case 2 : *d++ = ' ';
	              *d++ = B[++j];
	              *d++ = ' ';
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = '-';
		      *c++ = mt2[one][nx + DN[j]];
		      *c++ = '-';
		      break;
	     case 3 : *d++ = B[++j];
	              *d++ = ' ';
	              *d++ = ' ';
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = mt1[one][DN[j]];
		      *c++ = '-';
		      *c++ = '-';
		      break;
	     case 4 : *d++ = ' ';
	              *d++ = B[++j];
		      y = DN[j];
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = '-';
		      *c++ = mt2[one][z = nx + y];
		      *c++ = mt3[one][z * DNASIZE + DN[j]];
		      break;
	     case 5 : *d++ = B[++j];
		      y = DN[j];
	              *d++ = ' ';
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = mt1[one][y];
		      *c++ = '-';
		      *c++ = mt3[one][y * dnals2 + nx + DN[j]];
		      break;
	     case 6 : *d++ = B[++j];
		      y = DN[j];
	              *d++ = B[++j];
	              *d++ = ' ';
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = mt1[one][y];
		      *c++ = mt2[one][y * DNASIZE + DN[j]];
		      *c++ = '-';
		      break;
	     case 7 : *d++ = B[++j];
		      y = DN[j];
	              *d++ = B[++j];
		      z = DN[j];
	              *d++ = B[++j];
		      bbb = (z = y * DNASIZE + z) * DNASIZE + DN[j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = *letter++;
		      if ( AN[i] == da[bbb] )
		       { *c++ = ':';
		         *c++ = ':';
		         *c++ = ':';
		       }
		      else
		       { *c++ = mt1[one][y];
		         *c++ = mt2[one][z];
		         *c++ = mt3[one][bbb];
		       }
		      break;
	     case 8 : *d++ = B[++j];
		      y = DN[j];
	              *d++ = B[++j];
	              *d++ = B[++j];
		      z = DN[j];
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = ' ';
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = mt1[one][y];
		      *c++ = '-';
		      *c++ = mt2[one][z = y * DNASIZE + z];
		      *c++ = mt3[one][z * DNASIZE + DN[j]];
		      break;
	     case 9 : *d++ = B[++j];
		      y = DN[j];
	              *d++ = B[++j];
		      z = DN[j];
	              *d++ = B[++j];
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *a++ = ' ';
		      *a++ = *letter++;
		      *c++ = mt1[one][y];
		      *c++ = mt2[one][z = y * DNASIZE + z];
		      *c++ = '-';
		      *c++ = mt3[one][z * DNASIZE + DN[j]];
		      break;
	     case 10 : *d++ = B[++j];
		      y = DN[j];
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = mt1[one][y];
		      *c++ = mt2[one][z = y * DNASIZE + DN[j]];
		      break;
	     case 11 : *d++ = B[++j];
		      *a++ = *letter++;
		      *c++ = mt3[one][z * DNASIZE + DN[j]];
		      break;
	     case 12 : *d++ = B[++j];
		      *a++ = *letter++;
		      *c++ = mt1[one][y = DN[j]];
		      break;
	     case 13 : *d++ = B[++j];
		      z = DN[j];
	              *d++ = B[++j];
		      *a++ = *letter++;
		      *a++ = *letter++;
		      *c++ = mt2[one][z = y * DNASIZE + z];
		      *c++ = mt3[one][z * DNASIZE + DN[j]];
		      break;
	     default : break;
	   }
        }
      else
        { if (op == 0)
            op = *S++;
          if (op > 0)
            { *d++ = B[++j];
	      *a++ = ' ';
              *c++ = '-';
              op--;
            }
          else
            { letter = ttt[AN[++i]];
	      *a++ = *letter++;
	      *a++ = *letter++;
	      *a++ = *letter++;
              *d++ = ' ';
              *d++ = ' ';
              *d++ = ' ';
              *c++ = '-';
              *c++ = '-';
              *c++ = '-';
              op++;
            }
        }
      if (a >= ALINE+60 || i >= M && j >= N)
        { *a = *d = *c = '\0';
	  ls = a - ( ALINE+60 );
	  if ( ls > 0 )
	   { strcpy(atemp, a = ALINE+60);
	     strcpy(dtemp, DLINE+60);
	     strcpy(ctemp, CLINE+60);
	     ALINE[60] = '\0';
	     DLINE[60] = '\0';
	     CLINE[60] = '\0';
	   }
          (void) printf("\n%7d ",60*lines++);
          for (e = ALINE+10; e <= a; e += 10)
            (void) printf("    .    :");
          if (e <= a+5)
            (void) printf("    .");
	  mdp = orient ? dp : (dnalen - dp + 1);
          (void) printf("\n%7d %s\n        %s\n%7d %s\n",mdp,DLINE,CLINE,ap,ALINE);
	  ap = AP + i;
	  dp = DP + j;
	  if ( ls > 0 )
	   { for ( e = dtemp; *e ; )
	       if ( *e++ != ' ' )
		  dp--;
	     for ( a = ALINE, e = atemp; *a++ = *e++; );
	     for ( d = DLINE, e = dtemp; *d++ = *e++; );
	     for ( c = CLINE, e = ctemp; *c++ = *e++; );
	     a--;
	     d--;
	     c--;
             if ( i >= M && j >= N)
               { (void) printf("\n%7d ",60*lines++);
                 for (e = ALINE+10; e <= a; e += 10)
                   (void) printf("    .    :");
                 if (e <= a+5)
                   (void) printf("    .");
	         mdp = orient ? dp : (dnalen - dp + 1);
                 (void) printf("\n%7d %s\n        %s\n%7d %s\n",mdp,DLINE,CLINE,ap,ALINE);
               }
	   }
	  else
	   { a = ALINE;
	     d = DLINE;
	     c = CLINE;
	   }
        }
    }
}

/* lib.c - library of C procedures. */

/* fatal - print message and die */
fatal(msg)
char *msg;
{
	(void) fprintf(stderr, "%s\n", msg);
	exit(1);
}

/* fatalf - format message, print it, and die */
fatalf(msg, val)
char *msg, *val;
{
	(void) fprintf(stderr, msg, val);
	(void) putc('\n', stderr);
	exit(1);
}
	
/* ckopen - open file; check for success */
FILE *ckopen(name, mode)
char *name, *mode;
{
	FILE *fopen(), *fp;

	if ((fp = fopen(name, mode)) == NULL)
		fatalf("Cannot open %s.", name);
	return(fp);
}

/* ckalloc - allocate space; check for success */
char *ckalloc(amount)
int amount;
{
	char *malloc(), *p;

	if ((p = malloc( (unsigned) amount)) == NULL)
		fatal("Ran out of memory.");
	return(p);
}
